点击显示 收起
Department of Microbiology and Immunology, Stanford University School of Medicine, Stanford, CA 94305
T cell responses are critical to the survival of Yersinia-infected animals. Yersinia have the ability to directly suppress T lymphocyte activation through the virulence factor YopH, a tyrosine phosphatase. Using single cell video microscopy and FACS analysis, here we show that even an average of one Yersinia per T cell is sufficient to inhibit or alter T cell responses. This efficient inhibition is traced to specific targeting by YopH of the adaptor proteins, linker for activation of T cells (LAT) and SH2-domain–containing leukocyte protein of 76 kD (SLP-76), which are crucial for T cell antigen receptor (TCR) signaling. A catalytically inactive YopH translocated via the type III secretory pathway from the bacteria into T cells primarily binds to LAT and SLP-76. Furthermore, among the proteins of the TCR signaling pathway, the tyrosine phosphorylation levels of LAT and SLP-76 are the most affected in T cells exposed to low numbers of Yersinia pseudotuberculosis. This is the first example showing that a pathogen targets these adaptor proteins in the TCR signaling pathway, suggesting a novel mechanism by which pathogens may efficiently alter T cell–mediated immune responses.
Abbreviations used: FAK, focal adhesion kinase; Gads, Grb2-like adaptor protein downstream of Shc; GST, glutathion S-transferase; HA, hemagglutinin; HRP, horseradish peroxidase; LAT, linker for activation of T cells; MCC, moth cytochrome c; MOI, multiplicity of infection; PH, pleckstrin homology; PI3K, phosphoinositide 3–kinase; SLAP-130, SLP-76–associated phosphoprotein of 130 kD; SLP-76, SH2-domain–containing leukocyte protein of 76 kD; YFP, yellow fluorescent protein.
The success of a pathogen in establishing an infection is dependent on its ability to avoid or resist host defense mechanisms. Although there is ample information on the mechanisms used by pathogenic bacteria to subvert the innate immune defense system, very little is known about how they affect the adaptive immune response (for review see reference 1). Yet, it is clear that the T cell response remains essential for the clearance of bacterial pathogens, including the pathogenic members of the genus Yersinia (2, 3). The genus Yersinia includes Yersinia pestis, the causative agent of plague, as well as Yersinia pseudotuberculosis and Yersinia enterocolitica. The latter two cause gastroenteritis and lymphadenitis and, in susceptible individuals, the infections have also been associated with the development of reactive arthritis (4).
Yersinia's virulence strategy is to modify host cell functions by injecting several effector proteins (the Yersinia outermembrane proteins, Yops) by a type III secretory pathway into the host cell upon contact (5). Studies of the in vitro effects of the Yops on macrophages and epithelial cell lines have been extensive (for reviews see references 5, 6). During the course of infection, Yersinia are also likely to encounter lymphocytes as the bacteria colonize and multiply extracellularly in the Peyer's patches, lymph nodes, and subsequently in the spleen and liver. T cells as well as macrophages are present in Yersinia-induced lesions in spleen and liver (2). We found that T cells transiently exposed to Yersinia are inhibited in their ability to be activated through the TCR and, thus, cannot mount subsequent effector functions (7). This is one of the first examples of a bacterial pathogen that directly inhibits T cell activation.
The virulence factor YopH, a potent phosphatase (8–10), was primarily responsible for this inhibitory effect (7). Surprisingly, YopE, YopT, and YpkA that are known to disrupt actin filaments leading to alterations in the cytoskeleton of both phagocytes and epithelial cells (5, 6) have no effects on T cells despite the fact that a redistribution and reorientation of the cytoskeleton occurs during lymphocyte activation. Furthermore, although the virulence factor YopJ was found to induce apoptosis in macrophages in vivo (11) and to suppress TNF- and IL-8 production in macrophages in vitro (5, 6), it has no effect on T cells or TCR-mediated cytokine secretion. Thus, it appears that T lymphocyte functions are specifically targeted by YopH.
YopH was shown in in vitro assays to block the oxidative burst of macrophages (12), to inhibit calcium signaling in neutrophils (13), to induce disassembly of focal adhesions in epithelial cells (14, 15), and to inhibit phagocytosis (16). These studies and our own previous investigation were all performed with a rather high multiplicity of infection (MOI) of >50. Yet, in vivo the bacteria to host cell ratio must be low, at least at the time of initial infection. Therefore, we set out to determine the efficacy and mechanism of YopH's inhibition of T cell activation.
Here, we report that YopH alters T cell function even at a level of just one bacterium per T cell. Consistent with such high efficiency, we show that the adaptor molecules linker for activation of T cells (LAT) and SH2-domain–containing leukocyte protein of 76 kD (SLP-76) that are phosphorylated in response to TCR stimulation and are essential for T cell activation are primary targets of YopH. We find that although YopH has a broad targeting capability, it is quite specific in an infection where the bacteria/target cell ratio is low.
Results
Yersinia inhibit T cell responses efficiently
To determine the efficacy of YopH's inhibition of TCR-mediated activation, we analyzed the calcium flux of Y. pseudotuberculosis–exposed T cells as well as the recruitment of phosphoinositide 3–kinase (PI3K) to the immunological synapse, which both are important early events in T cell signaling (17–21).
T cell blasts prepared from 5C.C7 TCR (specific for moth cytochrome c peptide/I-Ek) transgenic mice (22) were exposed to wild-type Y. pseudotuberculosis at MOIs of 1, 2, 5, 10, 20, and 50 for 1 h and concurrently loaded with the calcium-sensitive dye indo-1 for 30 min. Their ability to flux calcium in response to CD3 cross-linking was analyzed by flow cytometry. Ratiometric analysis showed that the calcium flux of a T cell population exposed to an MOI of 1 was substantially reduced (Fig. 1 A). Incubations with higher MOIs resulted in a delayed response and a further reduction of the intracellular calcium flux levels. Consistent with our previous finding that YopH is the primary virulence factor affecting T cell responses (7), we found no inhibition of calcium flux when T cells were exposed to a Yersinia mutant expressing a catalytically inactive YopH, even at an MOI of 50 (Fig. 1 A). The catalytically inactive YopH stably traps its targets and thereby likely impairs downstream events. However, because only a limited mount of YopH is translocated into the host cell even at an MOI of 50, a large number of phosphorylated signaling proteins is not bound to the substrate trap (unpublished data).
Analysis of calcium levels in individual cells at the peak of calcium flux (Fig. 1 A, asterisks) showed that both the number of cells fluxing calcium and the magnitude of the calcium flux are reduced in T cell populations exposed to Y. pseudotuberculosis (Fig. 1 B). The dose response curve fits the model of a Gaussian distribution of the number of bacteria encountering the T cells where one bacterium per T cell is sufficient to inhibit the T cell response. Similar results were obtained using the human Jurkat T cell line (unpublished data).
To evaluate the response of individual cells, the calcium flux of fura-2 (a calcium-sensitive dye) loaded 5C.C7 T cell blasts exposed to Yersinia at different MOIs and stimulated by murine CH27 B cells presenting the MCC peptide was analyzed using video fluorescence microscopy (Fig. 2). As seen before (Fig. 1), with increasing MOI, an increasing percentage of the cells could no longer flux calcium. Interestingly, a subset of exposed T cells (10% at an MOI of 1 and 50% at an MOI of 10) exhibited a "sparking" phenotype where the initial increase of intracellular calcium was almost at the level of stimulated unexposed T cells, but was followed by a rapid decline to the basal level in 5 min. In contrast, unexposed T cells (Fig. 2) or T cells incubated with a mutant strain of Y. pseudotuberculosis expressing inactive YopH (not depicted) maintained their elevated calcium concentrations for >10 min.
PI3K activity was assayed indirectly by expressing the pleckstrin homology (PH) domain of AKT (also known as protein kinase B) fused to the yellow fluorescent protein (YFP) (PH-YFP) in T cells as described by Huppa et al. (21). The binding of 3'-phosphoinositides (the products of PI3K) by the PH domain results in an accumulation of PH(AKT)-YFP at sites of PI3K activity (20, 21). In unexposed 5C.C7 T cell blasts expressing PH(AKT)-YFP, antigen stimulation resulted in a rapid and sustained accumulation at the immunological synapse (front-accumulation) of PH(AKT)-YFP (Fig. 2). In Y. pseudotuberculosis–exposed T cell blasts, PH(AKT)-YFP accumulation was affected. T cells that did not respond to antigen-presenting cells by elevating their level of intracellular calcium also did not accumulate PH(AKT)-YFP. Observations that YopH inhibits PI3K-dependent T cell proliferation and IL-2 production (23) are consistent with this result. Exposed T cells exhibiting the sparking calcium flux also showed a transient front-accumulation of PH(AKT)-YFP. These results demonstrate that low numbers of Y. pseudotuberculosis can either abolish or alter T cell activation. Infection with Yersinia strains lacking a catalytically active YopH did not have any inhibitory effect (unpublished data). The simultaneous inhibition of calcium flux and PI3K activity suggests that YopH targets a common step in the signaling cascade upstream of PI3K and phospholipase C-1, which is essential for the calcium flux. Partial inhibition of this step may lead to the sparking phenotype.
Phosphorylated LAT and SLP-76 in activated T cells are primarily targeted by YopH
After T cell activation through the TCR, the TCR CD3 chains, antigen receptor-associated tyrosine kinases, such as Lck and ZAP-70, and adaptor/linker proteins, including LAT and SLP-76, are phosphorylated immediately. This precedes all downstream signaling events including calcium flux and the activation of PI3K. To understand how YopH inhibits TCR signaling, we followed up on our previous finding that, in activated Jurkat T cells exposed to Y. pseudotuberculosis at an MOI of 50, most of the TCR signaling–associated molecules were either not phosphorylated, or hypophosphorylated (7). To test whether YopH broadly targets most members of the TCR signaling complexes, or selectively few members of the complex whose lack of phosphorylation would lead to the hypophosphorylation of other members of the TCR signaling complex and the inability of inducing calcium flux and PI3K activity, we analyzed the tyrosine phosphorylation patterns of activated T cells exposed to wild-type Y. pseudotuberculosis at lower MOIs. Initial experiments were performed in Jurkat cells. T cell activation of primary murine 5C.C7 T cells and the human Jurkat T cells are similar in their sensitivity to Y. pseudotuberculosis infection (unpublished data). However, the biochemistry of antigen receptor signaling complexes is well characterized in Jurkat cells and mutant Jurkat lines defective in the TCR signaling pathway are available.
As shown in Fig. 3, even in activated Jurkat cells exposed to Y. pseudotuberculosis at an MOI of only 1.5, the overall tyrosine phosphorylation in response to TCR stimulation was reduced. The most substantial decrease was observed for phosphorylated LAT and SLP-76 (Fig. 3, A, lanes 2 and 4, and B). In contrast, Lck, Tyr394, CD3, and ZAP-70, which are phosphorylated earlier in the signaling cascade, and SLP-76–associated phosphoprotein of 130 kD (SLAP-130; an adaptor protein binding to SLP-76, also known as Fyb, or ADAP) were not as affected. This trend continued in activated Jurkat cells exposed at an MOI of 5. After exposure at an MOI of 15, most TCR signaling proteins were uniformly hypophosphorylated, but Tyr394-phosphorylated Lck was still clearly detectable. The efficient dephosphorylation of TCR signaling proteins is consistent with the results that calcium flux and PI3K activity of T cells are efficiently altered by exposure to Y. pseudotuberculosis (Figs. 1 and 2). Recently, it was demonstrated that YopH inhibits the activity of recombinant Lck in vitro and that Tyr394-phosphorylated Lck is a target of YopH in in vitro immunoprecipitations with relatively high amounts of YopH (24). This has led to the hypothesis that YopH prevents T cell antigen receptor signaling by inhibiting Lck as the first step in the signaling cascade. Therefore, we analyzed Lck activity in Yersinia-exposed T cells. As shown in Fig. 3 C, no difference in the activity of Lck in T cells exposed to low MOIs of Yersinia (MOIs 1.5 and 5) or unexposed cells was observed, indicating that the hypophosphorylation of signaling molecules at these MOIs does not result from a reduction of Lck activity. Only at higher MOIs (15 and 50), we did find an inhibition of Lck activity. The results indicate that although YopH appears to have the ability to target multiple proteins in T cells at higher MOIs, LAT and SLP-76 or molecules responsible for their phosphorylation, but not Lck, are primary targets of YopH at a low bacteria to T cell ratio.
YopH dissociates from its substrates after dephosphorylation. Catalytically inactive forms of YopH that forms stable complexes with its substrates (8) have been used as a substrate trap to identify its catalytic targets (14, 15, 24–27). It is well documented that signaling complexes in mammalian cells are organized in modules. Preferential sequestration and localization of molecules in the modules confer the specificity and the selectivity of activation. Thus, to identify YopH's targets in infected cells, we constructed two Y. pseudotuberculosis strains (designated as yopHC403A-HA and yopHD356A-HA) that can deliver a hemagglutinin (HA)-epitope tagged substrate trap form of YopH (YopHC403A-HA or YopHD356A-HA) into host cells through their type III secrectory pathway. This was to ensure that the translocated substrate-trap YopH would be similarly localized in T cells as wild-type YopH. The YopHC403A substrate trap has previously been used extensively to identify YopH targets in macrophages and epithelial cells (14, 15, 25–27). For some phosphatases though, mutation of the conserved aspartate (D356 in YopH) has been found to result in a more efficient substrate trap (28). We performed identical experiments and found no difference in any of the results. For simplicity, only the results obtained using yopHC403A-HA are presented. A Y. pseudotuberculosis strain that delivers YopH-HA (designated as yopH-HA) was also generated as a control.
Jurkat cells were exposed to wild-type, YopH-deficient (YopH), yopH-HA, and yopHC403A-HA Y. pseudotuberculosis, followed by activation with the CD3-specific antibody OKT3. As shown in Fig. 4, wild-type– as well as yopH-HA–exposed Jurkat cells showed no observable phosphorylation in response to TCR stimulation (lanes 8 and 10), indicating that the HA-tag does not affect the activity of YopH. In contrast, exposure to YopH or yopHC403A-HA Yersinia did not inhibit TCR signaling even at an MOI of 50 (lanes 4 and 6). Comparable amounts of YopH, YopH-HA, and YopHC403A-HA were present in the exposed T cells (Fig. 4, YopH).
The level of SLP-76 phosphorylation before TCR stimulation was much higher in Jurkat cells exposed to yopHC403A-HA at an MOI of 50 (lane 5) than in unexposed or YopH-exposed cells (lanes 1 and 3). Also LAT, SLAP-130, and Vav, were also found to be slightly hyperphosphorylated before TCR stimulation and significantly hyperphosphorylated after TCR activation. It has been observed previously that binding of a phosphatase substrate-trap to its target protects it from endogenous phosphatases, resulting in a relative increase in the phosphorylated form of these molecules (28). These results suggest that phosphorylated LAT, SLP-76, SLAP-130, and Vav, rather than molecules responsible for their phosphorylation, are direct targets of YopHC403A-HA in T cells exposed at the MOI of 50.
Lck, CD3, and ZAP-70 are phosphorylated earliest in the TCR-mediated signaling pathway. This leads to the phosphorylation of LAT and the recruitment of several proteins, including phospholipase C-1, PI3K, and Grb2-like adaptor protein downstream of Shc (Gads). SLP-76 is constitutively associated with Gads and, thus, is recruited to the TCR signaling complex and subsequently phosphorylated. Phosphorylated SLP-76 attracts more proteins, including SLAP-130 and Vav, to the protein assembly, referred to as the LAT/SLP-76 signalosome (19, 29, 30).
As shown in Fig. 5, a significant amount of phosphorylated SLP-76, and in addition phosphorylated LAT and SLAP-130, the unphosphorylated Gads and two unidentified phosphorylated proteins of 50-kD and 65-kD size (lane 2) coprecipitated with YopHC403A-HA in lysates of activated Jurkat cells exposed to yopHC403A-HA at an MOI of 2. Phosphorylated Vav was present in the precipitate derived from T cells exposed at an MOI of 50 (unpublished data). Also a small amount of Lck was detected in YopHC403A precipitates from cells exposed to an MOI of 50. The precipitated 50- and 65-kD protein are likely to be part of the LAT/SLP-76 signalosome because phosphorylated proteins of 50- and 65-kD size also coprecipitated with LAT or SLP-76 from extracts of activated Jurkat cells (unpublished data).
Because the coupling of the integrin signaling pathway with the TCR activation pathway is known to be defective in Jurkat cells and Yersinia attachment was found to trigger the integrin signaling cascade in macrophages and epithelial cells, we assessed targets of YopHC403A-HA in 5C.C7 T cell blasts. We did not find focal adhesion kinase (FAK), paxillin, or p130cas, which are primary targets of YopH in macrophages and epithelial cells (14, 15, 25, 26), nor did we find the closely related PYK2 (to FAK) and p105CasL (to p130cas), but again found LAT, SLP-76, and SLAP-130 and two proteins of 50 and 65 kD to be targets (unpublished data).
To verify that binding of YopHC403A-HA to the coprecipitating proteins occurred in the T cells and was not a result of YopHC403A-HA binding to host proteins in the lysate, we incubated Jurkat T cells with a mutant Yersinia strain that is incapable of translocating YopH into eukaryotic cells, an lcr mutant (31) expressing YopH-HA. The infection did not affect TCR-stimulated tyrosine phosphorylation (Fig. 6 A), and we were not able to precipitate YopH-HA from lysates of the exposed T cells, even though the lcr mutant synthesized similar amounts of the epitope-tagged YopH compared with the wild-type strain (Fig. 6, B and C). These results showed that, under the experimental conditions we used for T cell lysis, there was no concomitant lysis of Yersinia and that the precipitated YopH protein was that which had been injected into T cells.
Although we did not detect CD3 or ZAP-70 in our coprecipitates when substrate trap YopH was injected into T cells by Yersinia, CD3 and ZAP-70 were found to coprecipitate with YopHC403A in in vitro immunoprecipitations when the protein was added to lysates of activated Jurkat cells in amounts similar to what is translocated by the bacteria at an MOI of 2 (unpublished data). Thus, YopHC403A appears to bind less specifically in vitro. Also when using WT YopH for in vitro immunoprecipitations, we found LAT, SLP-76, SLAP-130, ZAP-70, and CD3, indicating that binding to these proteins is not limited to substrate trap YopH (unpublished data).
Because several phosphorylated proteins of the LAT/SLP-76 signalosome were found to precipitate with the substrate-trap YopH in exposed T cells, it was possible that the substrate trap YopH bound directly to every coprecipitated protein, or that it bound to one or a few of the proteins and precipitated the entire complex. To distinguish between these possibilities, we characterized YopH targets in Jurkat cells that were either SLP-76 deficient (J14; reference 32) or LAT deficient (J.CaM2; reference 33). In J14 cells, LAT and the 65-kD protein still coprecipitated with YopHC403A-HA (Fig. 7 A, lane 9). SLAP-130 and the 50-kD protein were barely detectable. This indicates that their association with YopHC403A-HA in wild-type T cells is mediated largely via SLP-76. In activated J.CaM2 cells, the lack of LAT expression resulted in a general reduction of phosphorylation level. Phosphorylated SLP-76 could not be detected in the T cell lysate. No phosphorylated proteins were found to coprecipitated with YopHC403A-HA (lane 7) after exposure to an MOI of 2. Because the signaling cascade from the T cell receptor is interrupted in these Jurkat mutants, we stimulated yopHC403A-HA–exposed Jurkat cells (MOI 2) with per-vanadate to increase the phosphorylation of signaling molecules (Fig. 7 B). The Lck-deficient Jurkat line J.CaM1 (34) was also included in these experiments. In activated J.CaM1 cells, the overall phosphorylation level was greatly reduced compared with wild-type Jurkat cells. However, SLP-76, LAT, the 65-kD protein, and SLAP-130 still coprecipitated with YopHC403A, indicating that the presence of Lck is not required for the binding of those proteins to YopHC403A. In the LAT-deficient Jurkat line, SLP-76, SLAP-130, and the 50- and 65-kD proteins were detected, indicating that the binding of YopHC403A to these proteins is not dependent on LAT. In addition, we detected ZAP-70 coprecipitating with YopHC403A in these experiments, suggesting that artificial hyperphosphorylation of signaling molecules allows YopH to bind to additional proteins.
Targeting of additional proteins by YopH could also be observed by in J.CaM2 cells exposed to yopHC403A-HA at an MOI of 50 and activated through the TCR. Under these conditions, phosphorylated SLAP-130 as well as phosphorylated CD3 and ZAP-70 coprecipitated with YopHC403A-HA, indicating that a loss of YopH specificity occurs when it is present at high concentration. This finding correlates with the observation that at high MOIs, CD3 and ZAP-70 were dephosphorylated by Y. pseudotuberculosis (Fig. 3), as were most of the TCR signaling proteins. These results indicate that, whereas YopH has a preference for LAT and SLP-76 in T cells, in their absence, or at higher concentrations of YopH, additional proteins will be targeted.
Discussion
Suppression or evasion of host immune responses is necessary for pathogenic bacteria to establish infection. In previous work, we showed that Yersinia have the ability to directly suppress T cell reactivity and that this inhibition is dependent on the virulence factor YopH (7). In this paper, we showed that the inhibitory effect of YopH is very potent as an average of one bacterium per T cell is sufficient to inhibit or alter T cell responses. We traced the efficient inhibiting effect of YopH to its primary targeting of the adaptor molecules LAT and SLP-76 in the TCR signaling cascade. In addition, a 65-kD protein that coprecipitated with YopHC403A in wild-type and SLP-76–deficient Jurkat T cells also appears to be a primary target of YopH. This protein is likely to be part of the LAT/SLP-76 signalosome and it will be interesting to reveal its function. LAT and SLP-76 are essential for T cell activation and function (32, 33, 35) and targeting of LAT and SLP-76 alone by YopH can explain the YopH-dependent effects in T cell signaling we observed. This is the first time that LAT and SLP-76 are found to be the targets of a pathogen and underscores the importance of the adaptor proteins in the T cell response in an infection.
Our results are different from those reported by Alonso et al. (24), who found Lck, especially tyrosine 394 of Lck, to be the main target of YopH. The discrepancies are most likely due to differences in the amount of YopH used and the manner of its delivery into the cells. We constructed Yersinia strains that inject substrate trap YopH into cells to ensure that the mutant YopH is delivered by the same route and in similar quantity as translocated WT-YopH. Alonso et al. expressed YopH in transiently transfected T cells, treated T cells with membrane-permeable YopH, or added YopH to lysed cells. Furthermore, to identify targets of YopH, Alsonso et al. added 150 times as much substrate trap YopH to T cell lysates as is translocated by Yersinia at an MOI of 2. Indeed, at an MOI of 50, we also see Lck being targeted by YopH.
The ability to alter T cell signaling as seen in the sparking phenotypes of calcium flux and PI3K activity is consistent with our identification of LAT and SLP-76 as major targets of YopH. The sparking pattern of calcium flux is similar to the ones observed in T cells with a deletion of Itk, a Tec family kinase that associates with phosphorylated SLP-76 (36), or a mutation in LAT. In the Itk-deficient T cells, TCR stimulation results in a substantial reduction in IP3 generation and defects in IL-2 production. Jurkat cells expressing LAT Tyr132Phe or T cells from "knockin" mice homozygous for LAT Tyr136Phe (Tyr136 in murine LAT is equivalent to Tyr132 in human LAT) also are deficient in their ability to respond to TCR stimulation (37, 38). Partial dephosphorylation of LAT and SLP-76 might be conferred by very limited quantities of injected YopH and, thus, could profoundly alter TCR-mediated signaling and the subsequent responses in Yersinia infection. This suggests that, during a Yersinia infection, a wide range of T cell–mediated responses may be affected. In addition, abnormal T cell signaling has been linked to the development of autoimmune diseases, particularly rheumatoid arthritis, in which the aberrant T cell signaling has been linked to severely impaired phosphorylation of LAT (39). One might speculate that the ability of Y. pseudotuberculosis to disrupt or alter T cell signaling could also play a role in triggering this disease.
When exposing T cells to Yersinia at low MOIs, wild-type as well as substrate trap YopH injected into T cells through the type III secretion system primarily targets LAT and SLP-76, but not Lck, CD3, or ZAP-70, even though the latter three molecules are phosphorylated earlier during T cell activation. The selectivity of YopH may in part result from the amino acid sequences of the target proteins. In vitro analysis has shown that the optimum peptide sequence for YopH catalysis is D/E D/E pYxxP (40). The amino-terminus of YopH that exhibits a substrate-binding domain that binds substrates directly in a phosphotyrosine-dependent manner (25) contributes to this selectivity. Both, SLP-76 and LAT, but not CD3, ZAP-70, and Lck, feature tyrosine phosphorylation sites comprising the optimal motif for YopH's phosphatase activity. However, when T cell lysates were incubated with an amount of YopHC403A similar to the amount injected by Yersinia into T cells at an MOI of 2, CD3 and ZAP-70 were found to bind to substrate trap YopH, indicating that there may be additional unidentified targeting mechanisms that contribute to YopH specificity. An additional targeting mechanism might be provided by the proline-rich region of YopH that shows the consensus motif for binding to Src homology 3 domains (25, 41) and that might confer binding in a phosphorylation-independent manner. Studies in macrophages did not find this region of YopH to be important for the targeting of YopH (25, 42). However, Src homology 3 domains are present (e.g., in the small adaptor Gads), but we did not find any evidence that catalytically active YopH has the ability to bind to Gads (unpublished data).
The difference in the specificity of YopH when delivered into live cells compared with in vitro experiments suggests that the accessibility of signaling complexes in live cells plays an important role. Many signaling complexes in mammalian cells are organized into modules and preferential sequestration and localization of these modules allows for specificity and selectivity of activation. Furthermore, cellular compartmentalization and localization is important for the in vivo substrate specificity of phosphatases that have a broad substrate spectrum in vitro (43). Thus, delivery of YopH through the type III secretory pathway likely determines the interactions of YopH with the host cell signaling modules. In addition, specificity of YopH is also influenced by its concentration. In T cells exposed to higher MOIs, YopH targets additional proteins, including Lck. This indicates that, although YopH shows broad targeting capabilities, it is very specific at low bacteria to host cell ratios, a likely situation in infections in vivo.
Despite the observation that the action of Yop effectors shows no cell specificity among various adherent cells lines (44), YopH is the only Yersinia effector protein affecting T cells (7). The data presented here suggest that Yersinia may have developed a sophisticated mechanism to target effector proteins to special cellular compartments so that the effect of the few virulence factors delivered by a few bacteria can be maximized. This strategy may not be limited to Yersinia because type III secretion systems have been found in other pathogenic microorganisms, such as Salmonella, Shigella, and Chlamydia, that are also associated with reactive arthritis in humans (45). It is likely that these bacteria secrete molecules analogous to Yops that may alter host cell function and the immune response to the benefit of the microbe. For example, Salmonella translocates the effector protein, SptP, which has domains corresponding to those found in the Yersinia YopH and YopE (46).
In conclusion, we have identified a novel and efficient mechanism by which bacteria alter T cell responsiveness. These findings may have general applicability to the understanding of bacterial pathogenicity and the development of immune responses during infection.
Materials and Methods
Cell lines, Y. pseudotuberculosis strains, and growth conditions.
Wild-type Jurkat T cells E6.1 (47) and the mutant Jurkat T cell lines J.CaM1 (Lck-deficient; reference 34), J.CaM2 (LAT-deficient; reference 33), and J14 (SLP-76 deficient; reference 32) were maintained in IMDM medium (GIBCO BRL) containing 5% calf serum with iron and the standard supplements 5 mM L-glutamine, 50 μM -mercaptoethanol, and 50 μg/ml gentamycin at 37°C in 5% CO2. T cell blasts were derived from 5C.C7 TCR transgenic mice (specific for MCC/I-Ek; reference 22) by stimulating freshly isolated lymph node cells with MCC peptide (88–103) in supplemented RPMI 1640 medium containing 10% FBS. 25 U/ml IL-2 was added 24 h after stimulation. 5C.C7 T cell blasts expressing PH(AKT)-YFP were generated by retroviral transfection as described by Huppa et al. (21). T cell blasts were used on days 6 and 7 after initial stimulation. The B cell lymphoma line CH27 was used as antigen-presenting cells and maintained in complete RPMI 1640.
Wild-type Y. pseudotuberculosis YPIIIpIB1 (48), the YopH-deficient (YopH) strain YPIIIp502 (49), and newly generated mutant strains were grown in 2YT medium at 26°C and the appropriate antibiotics: 100 μg/ml ampicillin, and 32 μg/ml chloramphenicol. For T cell infections, overnight cultures were diluted to an OD578 of 0.1 into 2YT supplemented with 20 mM sodium oxalate and 20 mM magnesium chloride, grown for 2 h at 26°C, and shifted to 37°C for 2 h. Bacterial numbers were determined by OD578 = 109 bacteria/ml.
Y. pseudotuberculosis strains that secrete HA-tagged YopH or HA-tagged substrate trap YopH (designated as yopH-HA, yopHC403A-HA, and yopHD356A-HA, respectively), were generated as follows. The genes encoding YopH or YopHC403A were amplified including the promoter regions from YPIIIpIB1 or the substrate trap YopHC403A-expressing strain YPIIIpIB1C403A (9) and were inserted into pACYC184 (50). The HA-tag was introduced at the 3'-end of yopH and yopHC403A. The resulting plasmids pyopH-HA and pyopHC403A-HA were introduced into YPIIIp502. In addition, pyopH-HA was also introduced into the lcr mutant YPIIIpIB71 (31), yielding the strain lcr (pyopH-HA). pyopHD356A-HA was generated by site-directed mutagenesis of pyopH-HA using Quikchange (Stratagene) and introduced into YPIIIp502.
His-tagged YopHC403A (His-YopHC403A) as well as a glutathion S-transferase (GST) fusion protein of YopHC403A (GST-YopHC403A) were expressed in Escherichia coli. yopHC403A was inserted into pQE30 (QIAGEN) to produce His-YopHC403A. GST-YopHC403A was encoded by a pGEX-4T-1 (Amersham Biosciences) derivative containing yopHC403A.
Antibodies
A polyclonal antiserum to YopH was generated at Josman, LLC by immunizing rabbits with purified His-YopHC403A. The crude antiserum was affinity purified (51) using GST-YopHC403A fusion protein bound to glutathione sepharose (Amersham Biosciences). Anti–human CD3 (OKT3) was purified from hybridomas (American Type Culture Collection). In addition, antibodies against the following proteins and residues were used in this study: antiphosphotyrosine (4G10), LAT, Lck, Gads, ZAP-70, Vav, FAK (Upstate Biotechnology); CD3, actin (Santa Cruz Biotechnology, Inc.); SLP-76, SLAP-130, paxillin, p130cas, PYK2 (Transduction Laboratories); phospho-Lck Tyr394 (detected by anti–phospho-Src family [Tyr416] antibody; Cell Signaling), mouse CD3 (2C11)-biotin (BD Biosciences); HA-tag (HA.11; Covance). Anti–mouse IgG horseradish peroxidase (HRP) linked whole antibody and anti–rabbit IgG HRP linked F(ab')2 fragments were purchased from Amersham Biosciences.
T cell infection and activation
106 cells/ml Jurkat T cells or 2 x 106 cells/ml 5C.C7 T cell blasts were exposed to specific Y. pseudotuberculosis at a specified MOI for 1 h in prewarmed supplemented IMDM or RPMI 1640 without gentamycin in tissue culture plates at 37°C and 5% CO2. To facilitate contact between the bacteria and the T cells, the plates were spun for 3 min at 1,200 revolutions/min at the beginning of the infection. After the exposure, the T cells were collected in 1.5-ml tubes by centrifugation for 1.5 min (2 min for T cell blasts) at 1,600 revolutions/min (200 g) and washed four times with prewarmed PBS (37°C) to remove most of the unattached Yersinia.
Jurkat T cells were activated at 4 x 107 cells/ml in PBS at 37°C by adding OKT3 to a final concentration of 10 μg/ml. For the activation of T cell blasts, anti-CD3 2C11-biotin was preincubated with streptavidin and added at a final concentration of 10 μg/ml. For stimulation with per-vanadate (100 μM final concentration), ortho-vanadate was oxidized using H2O2, which was subsequently removed using catalase. After incubation for 2 min (vanadate 3 min), cells were spun down for 10 s at 4°C and lysed at 4 x 107 cells/ml (Jurkat) or 108 cells/ml (T cell blasts) in ice-cold TTS (25 mM Tris, pH 8.0, 150 mM NaCl, 1% Triton X-100, 1 mM Na3VO4, 10 mM -glycerolphosphate, 10 mM NaF, Complete protease inhibitors (Roche). Nuclei were removed by centrifugation for 10 min at 13,000 revolutions/min (16,000 g) at 4°C. Total lysates of 4 x 105 Jurkat cells or 2 x 106 T cell blasts were resolved by SDS-PAGE. Phosphotyrosine proteins were detected by immunoblot analysis using 4G10 antibody and the enhanced chemiluminescence system ECL (Amersham Biosciences). Blots were stripped according to the protocol provided by Amersham Biosciences and subjected to reprobing with appropriate antibodies. Results were quantified using the public domain NIH Image program (developed at the U.S. National Institutes of Health and available at http://rsb.info.nih.gov/nih-image).
Immunoprecipitation of YopH-associated proteins
To identify YopHC403A/YopHD356A targets in exposed T cells, 3 x 107 Jurkat T cells were exposed to yopHC403A-HA or yopHD356A-HA at an MOI of 2, activated, and lysed as described in the previous paragraph. Extracts were precleared using protein G agarose (Sigma-Aldrich) and subsequently incubated for 2 h at 4°C with affinity purified anti-YopH antibodies or anti-HA monoclonal antibodies (final concentration of 10 μg/ml) and protein G agarose. The agarose was collected by centrifugation for 3 min at 16,000 g at 4°C, washed three times with TTS buffer, and boiled with reducing SDS sample buffer. The proteins were separated by SDS-PAGE and analyzed by Western blot analysis. For in vitro immunoprecipitations, Jurkat cells were activated and lysed, and YopHC403A, YopHD356A, or YopH were added to the precleared lysate. YopH was preincubated in lysis buffer with 1 mM vanadate for 15 min to inactivate it before adding it to the lysate. To match the amount of purified YopH proteins added to the in vitro experiments with the amount translocated by Yersinia, we compared the amounts of YopH injected into Jurkat T cells with a titration curve of YopH. We found that 20 ng of protein are translocated by Yersinia into 107 T cells exposed at an MOI of 2.
Lck kinase assay
Jurkat T cells were exposed to Yersinia as described before, stimulated with OKT3, and lysed in kinase assay buffer KAB (25 mM Hepes, pH 7.4, 150 mM KCl, 5 mM MnCl, 5 mM MgCl2, 1 mM DTT, 1% Triton X-100, 1 mM Na3VO4). Lysates were precleared and incubated with 10 μg/ml anti-Lck monoclonal antibody and protein G agarose. The agarose was washed three times in KAB. Kinase activity was measured by ELISA as follows. The cytoplasmic domain of CD3 ( GGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN) was used as a substrate for Lck and was bound on streptavidin-coated Immulon 4 plates. Precipitated Lck was added for 30 min at 32°C in KAB containing 20 μM ATP. Phosphorylation of the CD3-peptides was quantified using antiphosphotyrosine antibody 4G10, anti–mouse IgG HRP conjugate and the HRP substrate OPD (Sigma-Aldrich) in comparison to a standard curve of phosphorylated CD3-peptide (0.05–12.5 ng/ml). Lck-deficient Jurkat cells (J.CaM1) were used as negative control.
Calcium flux and PI3K activity analysis
To analyze calcium flux by flow cytometry, 106 T cell blasts were exposed to specified Y. pseudotuberculosis strains and concurrently loaded with 2 μM indo-1, AM (Molecular Probes) for 30 min. T cells were collected by centrifugation at 1,600 revolutions/min (200 g) for 2 min in 1.5-ml tubes and washed twice with prewarmed antibiotic-free RPMI 1640 containing 25 mM Hepes, pH 7.4. Indo-1 loaded T cells were activated by the addition of 2C11-biotin antibody (preincubated with streptavidin) to a final concentration of 10 μg/ml. Calcium flux was analyzed at 37°C on a modified FACStar (FACS facility, Stanford University) by monitoring the ratio of 405/485 nm emission and time. As a positive control, 1 μM ionomycin (Sigma-Aldrich) was added to the T cells at the end of the measurement.
Calcium flux and the PI3K activity of T cells responding to antigenic stimulation were analyzed by single cell video microscopy using a Zeiss/Universal Imaging three-dimensional time-lapse system as described previously (21). 2 x 105 T cell blasts expressing the PH(AKT)-YFP were exposed to Yersinia and loaded with 1 μM fura-2, AM (Molecular Probes). After washing, the cells were resuspended in 200 μl prewarmed antibiotic-free RPMI 1640 supplemented with 25 mM Hepes, pH 7.4, and seeded into an eight-well glass-bottom chamber slide (Labtek/Nunc). 105 CH27 cells, preloaded with 1 μM MCC peptide for 1 h, were added to the T cells. Images were taken every 15 or 30 s for 15 min. At each time point, images of the two-dimensional differential interference contrast, the fura-2 fluorescence images (340/380 nm) and a z stack of YFP were recorded. Metamorph (Universal Imaging Corp.) was used for microscope control, data acquisition, and image analysis.
Acknowledgments
We thank J.B. Huppa for the phoenix cell lines producing PH(AKT)-YFP–expressing virus and introduction into live cell imaging, B.F. Lillemeier for the CD3 peptides and advice on the Lck kinase assay, and J.B. Bliska for the Yersinia strain YPIIIpIB1C403A. We thank M.M. Davis, J.B. Huppa, Y. Konigshofer, Q-J. Li, B.F. Lillemeier, D.M. Monack, A. Müller, S. Shin, and L.C. Wu for advice and critical reading of the paper and M.R. Amieva, J.C. Boothroyd, J.-T. Chi, M.A. Purbhoo, R. Sciammas, and T. Yao for discussion.
This work was supported by funding from the National Institutes of Health and the Stanford Digestive Disease Center grant no. DK56339 (to Y.-h. Chien and S. Falkow).
References
Hornef, M.W., M.J. Wick, M. Rhen, and S. Normark. 2002. Bacterial strategies for overcoming host innate and adaptive immune responses. Nat. Immunol. 3:1033–1040.
Autenrieth, I.B., U. Vogel, S. Preger, B. Heymer, and J. Heesemann. 1993. Experimental Yersinia enterocolitica infection in euthymic and T-cell-deficient athymic nude C57BL/6 mice: comparison of time course, histomorphology, and immune response. Infect. Immun. 61:2585–2595.
Autenrieth, I.B., M. Beer, E. Bohn, S.H.E. Kaufmann, and J. Heesemann. 1994. Immune responses to Yersinia enterocolitica in susceptible BALB/c and resistant C57BL/6 mice: an essential role for gamma interferon. Infect. Immun. 62:2590–2599.
Toivanen, A., K. Granfors, R. Lahesmaa-Rantala, R. Leino, T. Stahlberg, and R. Vuento. 1985. Pathogenesis of Yersinia-triggered reactive arthritis: immunological, microbiological and clinical aspects. Immunol. Rev. 86:47–70.
Cornelis, G.R., A. Boland, A.P. Boyd, C. Geuijen, M. Iriarte, C. Neyt, M.-P. Sory, and I. Stainier. 1998. The virulence plasmid of Yersinia, an antihost genome. Microbiol. Mol. Biol. Rev. 62:1315–1352.
Juris, S.J., F. Shao, and J.E. Dixon. 2002. Yersinia effectors target mammalian signalling pathways. Cell. Microbiol. 4:201–211.
Yao, T., J. Mecsas, J.I. Healy, S. Falkow, and Y.-h. Chien. 1999. Suppression of T and B lymphocyte activation by a Yersinia pseudotuberculosis virulence factor, YopH. J. Exp. Med. 190:1343–1350.
Guan, K.L., and J.E. Dixon. 1990. Protein tyrosine phosphatase activity of an essential virulence determinant in Yersinia. Science. 249:553–556.
Bliska, J.B., K.L. Guan, J.E. Dixon, and S. Falkow. 1991. Tyrosine phosphate hydrolysis of host proteins by an essential Yersinia virulence determinant. Proc. Natl. Acad. Sci. USA. 88:1187–1191.
Zhang, Z.-Y., J.C. Clemens, H.L. Schubert, J.A. Stuckey, M.W. Fischer, D.M. Hume, M.A. Saper, and J.E. Dixon. 1992. Expression, purification, and physicochemical characterization of a recombinant Yersinia protein tyrosine phosphatase. J. Biol. Chem. 267:23759–23766.
Monack, D.M., J. Mecsas, D. Bouley, and S. Falkow. 1998. Yersinia-induced apoptosis in vivo aids in the establishment of a systemic infection of mice. J. Exp. Med. 188:2127–2137.
Bliska, J.B., and D.S. Black. 1995. Inhibition of the Fc receptor-mediated oxidative burst in macrophages by the Yersinia pseudotuberculosis tyrosine phosphatase. Infect. Immun. 63:681–685.
Andersson, K., K.-E. Magnusson, M. Majeed, O. Stendahl, and M. Fllman. 1999. Yersinia pseudotuberculosis-induced calcium signaling in neutrophils is blocked by the virulence effector YopH. Infect. Immun. 67:2567–2574.
Black, D.S., and J.B. Bliska. 1997. Identification of p130Cas as a substrate of Yersinia YopH (Yop51), a bacterial protein tyrosine phosphatase that translocates into mammalian cells and targets focal adhesions. EMBO J. 16:2730–2744.
Persson, C., N. Carballeira, H. Wolf-Watz, and M. Fllman. 1997. The PTPase YopH inhibits uptake of Yersinia, tyrosine phosphorylation of p130Cas and FAK, and the associated accumulation of these proteins in peripheral focal adhesions. EMBO J. 16:2307–2318.
Rosqvist, R., I. Blin, and H. Wolf-Watz. 1988. Inhibition of phagocytosis in Yersinia pseudotuberculosis: a virulence plasmid-encoded ability involving the Yop2b protein. Infect. Immun. 56:2139–2143.
Cantrell, D.A. 2002. T-cell antigen receptor signal transduction. Immunology. 105:369–374.
Kane, L.P., J. Lin, and A. Weiss. 2000. Signal transduction by the TCR for antigen. Curr. Opin. Immunol. 12:242–249.
Jordan, M.S., A.L. Singer, and G.A. Koretzky. 2003. Adaptors as central mediators of signal transduction in immune cells. Nat. Immunol. 4:110–116.
Costello, P.S., M. Gallagher, and D.A. Cantrell. 2002. Sustained and dynamic inositol lipid metabolism inside and outside the immunological synapse. Nat. Immunol. 3:1082–1089.
Huppa, J.B., M. Gleimer, C. Sumen, and M.M. Davis. 2003. Continuous T cell receptor signaling required for synapse maintenance and full effector potential. Nat. Immunol. 4:749–755.
Fazekas de St. Groth B., P.A. Patten, W.Y. Ho, E.P. Rock, and M.M. Davis. 1993. An analysis of T cell receptor-ligand interaction using a transgenic antigen model for T cell tolerance and T cell receptor mutagensis. In Molecular Mechamisms of Immunological Self-Recognition. F.W. Alt and H.J. Vogel, editors. Academic Press, San Diego, CA. 123–127.
Sauvonnet, N., I. Lambermont, P. van der Bruggen, and G.R. Cornelis. 2002. YopH prevents monocyte chemoattractant protein 1 expression in macrophages and T-cell proliferation through inactivation of the phosphatidylinositol 3-kinase pathway. Mol. Microbiol. 25:805–815.
Alonso, A., N. Bottini, S. Bruckner, S. Rahmouni, S. Williams, S.P. Schoenberger, and T. Mustelin. 2004. Lck dephosphorylation at Tyr-394 and inhibition of T cell antigen receptor signaling by Yersinia phosphatase YopH. J. Biol. Chem. 279:4922–4928.
Black, D.S., L.G. Montagna, S. Zitsmann, and J.B. Bliska. 1998. Identification of an amino-terminal substrate-binding domain in the Yersinia tyrosine phosphatase that is required for efficient recognition of focal adhesion targets. Mol. Microbiol. 29:1263–1274.
Hamid, N., A. Gustavsson, K. Andersson, K. McGee, C. Persson, C.E. Rudd, and M. Fllman. 1999. YopH dephosphorylates Cas and Fyn-binding protein in macrophages. Microb. Pathog. 27:231–242.
Black, D.S., A. Marie-Cardine, B. Schraven, and J.B. Bliska. 2000. The Yersinia tyrosine phosphatase YopH targets a novel adhesion-regulated signalling complex in macrophages. Cell. Microbiol. 2:401–414.
Flint, A.J., T. Tiganis, D. Barford, and N.K. Tonks. 1997. Development of "substrate-trapping" mutants to identify physiological substrates of protein tyrosine phosphatases. Proc. Natl. Acad. Sci. USA. 94:1680–1685.
Tomlinson, M.G., J. Lin, and A. Weiss. 2000. Lymphocytes with a complex: adapter proteins in antigen receptor signaling. Immunol. Today. 21:584–591.
Griffiths, E.K., and J.M. Penninger. 2002. ADAP-ting TCR signaling to integrins. Sci. STKE. 2002:RE3.
Bliska, J.B., M.C. Copass, and S. Falkow. 1993. The Yersinia pseudotuberculosis adhesin YadA mediates intimate bacterial attachment to and entry into HEp-2 cells. Infect. Immun. 61:3914–3921.
Yablonski, D., M.R. Kuhne, T. Kadlecek, and A. Weiss. 1998. Uncoupling of nonreceptor tyrosine kinases from PLC-1 in an SLP-76-deficient T cell. Science. 281:413–416.
Finco, T.S., T. Kadlecek, W. Zhang, L.E. Samelson, and A. Weiss. 1998. LAT is required for TCR-mediated activation of PLC1 and the Ras pathway. Immunity. 9:617–626.
Straus, D.B., and A. Weiss. 1992. Genetic evidence for the involvement of the lck tyrosine kinase in signal transduction through the T cell antigen receptor. Cell. 70:585–593.
Zhang, W., B.J. Irvin, R.P. Trible, R.T. Abraham, and L.E. Samelson. 1999. Functional analysis of LAT in TCR-mediated signaling pathways using a LAT-deficient Jurkat cell line. Int. Immunol. 11:943–950.
Liu, K.-Q., S.C. Bunnell, C.B. Gurniak, and L.J. Berg. 1998. T cell receptor–initiated calcium release is uncoupled from capacitative calcium entry in Itk-deficient T cells. J. Exp. Med. 187:1721–1727.
Zhang, W., R.P. Trible, M. Zhu, S.K. Liu, C.J. McGlade, and L.E. Samelson. 2000. Association of Grb2, Gads, and phospholipase C-1 with phosphorylated LAT tyrosine residues. Effect of LAT tyrosine mutations on T cell antigen receptor-mediated signaling. J. Biol. Chem. 275:23355–23361.
Sommers, C.L., C.-S. Park, J. Lee, C. Feng, C.L. Fuller, A. Grinberg, J.A. Hildebrand, E. Lacaná, R.K. Menon, E.W. Shores, et al. 2002. A LAT mutation that inhibits T cell development yet induces lymphoproliferation. Science. 296:2040–2043.
Gringhuis, S.I., A. Leow, E.A. Papendrecht-Van Der Voort, P.H. Remans, F.C. Breedveld, and C.L. Verweij. 2000. Displacement of linker for activation of T cells from the plasma membrane due to redox balance alterations results in hyporesponsiveness of synovial fluid T lymphocytes in rheumatoid arthritis. J. Immunol. 164:2170–2179.
Zhang, Z.Y., A.M. Thieme-Sefler, D. Maclean, D.J. McNamara, E.M. Dobrusin, T.K. Sawyer, and J.E. Dixon. 1993. Substrate specificity of the protein tyrosine phosphatases. Proc. Natl. Acad. Sci. USA. 90:4446–4450.
Bliska, J. 1996. How pathogens exploit interactions mediated by SH3 domains. Chem. Biol. 3:7–11.
Persson, C., R. Nordfelth, K. Andersson, . Forsberg, H. Wolf-Watz, and M. Fllman. 1999. Localization of the Yersinia PTPase to focal complexes is an important virulence mechanism. Mol. Microbiol. 33:828–838.
Zhang, Z.-Y. 2002. Protein tyrosine phosphatases: structure and function, substrate specificity, and inhibitor development. Annu. Rev. Pharmacol. Toxicol. 42:209–234.
Boyd, A.P., N. Grosdent, S. Ttemeyer, C. Geuijen, S. Bleves, M. Iriarte, I. Lambermont, J.N. Octave, and G.R. Cornelis. 2000. Yersinia enterocolitica can deliver Yop proteins into a wide range of cell types: development of a delivery system for heterologous proteins. Eur. J. Cell Biol. 79:659–671.
Galán, J.E., and A. Collmer. 1999. Type III secretion machines: bacterial devices for protein delivery into host cells. Science. 284:1322–1328.
Kaniga, K., J. Uralil, J.B. Bliska, and J.E. Galán. 1996. A secreted protein tyrosine phosphatase with modular effector domains in the bacterial pathogen Salmonella typhimurium. Mol. Microbiol. 21:633–641.
Weiss, A., R.L. Wiskocil, and J.D. Stobo. 1984. The role of T3 surface molecules in the activation of human T cells: a two-stimulus requirement for IL-2 production reflects events occurring at a pre-translational level. J. Immunol. 133:123–128.
Portnoy, D.A., H. Wolf-Watz, I. Bolin, A.B. Beeder, and S. Falkow. 1984. Characterization of common virulence plasmids in Yersinia species and their role in the expression of outer membrane proteins. Infect. Immun. 43:108–114.
Mecsas, J., B. Raupach, and S. Falkow. 1998. The Yersinia Yops inhibit invasion of Listeria, Shigella and Edwardsiella but not Salmonella into epithelial cells. Mol. Microbiol. 28:1269–1281.
Chang, A.C.Y., and S.N. Cohen. 1978. Construction and characterization of amplifiable multicopy DNA cloning vehicles derived from the P15A cryptic miniplasmid. J. Bacteriol. 134:1141–1156.
Harlow, E., and D. Lane. 1988. Antibodies: a Laboratory Manual. Cold Spring Harbor Laboratory. Cold Spring Harbor, NY. 349 pp.